| TrapCLuster Report for TCL10263 |
| Internal ID | 10263 |
||||||||
| Accession | TCL10263 |
||||||||
| Sequence |
|
||||||||
| RNA length | 616 |
||||||||
| Overlapping | |||||||||
| Blocks | 1 |
||||||||
| Traps | 8 |
||||||||
| Distance from gene | 30673 |
||||||||
| Gene in slice | 0 |
||||||||
| Gene in slice (same strand) | 0 |
||||||||
| Human Conservation | 1 |
||||||||
| Dog Conservation | 1 |
||||||||
| Gallus Conservation | 1 |
||||||||
| Total Conservation | 1 |
||||||||
| LORF Length | 108 |
||||||||
| LORF-Blastp Result | 1 |
||||||||
| UTRscan Result | 0 |
||||||||
| Max UTR length | 0 |
||||||||
| Closest Gene (stable_id) | ENSMUSG00000051518 |
||||||||
| Closest Gene (name) | 2510038A11Rik |
||||||||
| Close to OMIM | 0 |
||||||||
| Disease | 0 |
||||||||
| Go To Ensembl |  |
||||||||
| Go To UCSC |  |
| Sorry, no results for your search. |
| Longest ORF | Translation | Length | Strand |
| gggtacaggagcagagacaacgccagtgcctctgggagca gggatgagacgcaccagcacagagtcacagcgacatgtcg ccttgcatggaacagtgtggggcttgccaatcttgttccc ccaatagcctctccacacagggatgatggaaaccttggcc aaggtgatggcttctcagatggcagtggcaacctccttgg agcacttaacgccaagaccaacgtgaccattgtagtcccc tatagggacgaaagccttgaacctggtccgctggccagcc cgagtctgcttctgcactggcatgattttcagaacctcat ccttt |
GYRSRDNASASGSRDETHQHRVTATCRLAWNSVGLANLVP PIASPHRDDGNLGQGDGFSDGSGNLLGALNAKTNVTIVVP YRDESLEPGPLASPSLLLHWHDFQNLIL |
108 | - |
| BLASTP Hit ID (ORF) | Description | Score | Start | End | Frac Aligned Query | Num Hsps | Frac Identical | Length | |
| UniRef90_UPI0000511B51 | Cluster related to UPI0000511B51; PREDICTED: hypothetical protein XP_485104 | 171 | 6 | 108 | 0.95 | 1 | 0.796 | 128 | view hsps |
| UniRef90_UPI0000511C5A | Cluster related to UPI0000511C5A; PREDICTED: hypothetical protein XP_622604 | 166 | 1 | 108 | 1 | 1 | 0.741 | 407 | view hsps |
| UniRef90_UPI0000511FDC | Cluster related to UPI0000511FDC; PREDICTED: hypothetical protein XP_619376 | 166 | 1 | 108 | 1 | 1 | 0.741 | 130 | view hsps |
| UniRef90_UPI00005126AC | Cluster related to UPI00005126AC; PREDICTED: hypothetical protein XP_620664 | 161 | 18 | 108 | 0.84 | 1 | 0.846 | 92 | view hsps |
| UniRef90_UPI0000507CF0 | Cluster related to UPI0000507CF0; PREDICTED: hypothetical protein XP_573671 | 125 | 1 | 99 | 0.92 | 1 | 0.657 | 171 | view hsps |
| UniRef90_UPI0000506407 | Cluster related to UPI0000506407; PREDICTED: similar to RIKEN cDNA C130037N17 gene | 120 | 1 | 73 | 0.68 | 1 | 0.795 | 955 | view hsps |
| UniRef90_UPI00004919F4 | Cluster related to UPI00004919F4; PREDICTED: similar to GRB2-associated binding protein 1 isoform a | 105 | 12 | 98 | 0.81 | 1 | 0.598 | 1089 | view hsps |
| UniRef90_UPI000049458A | Cluster related to UPI000049458A; PREDICTED: hypothetical protein XP_524020 | 84 | 24 | 95 | 0.67 | 1 | 0.597 | 917 | view hsps |
| UniRef90_Q6CKL2 | Kluyveromyces lactis strain NRRL Y-1140 chromosome F of strain NRRL Y- 1140 of Kluyveromyces lactis related cluster | 66 | 6 | 108 | 0.95 | 1 | 0.388 | 262 | view hsps |
| UniRef90_UPI0000490887 | Cluster related to UPI0000490887; PREDICTED: similar to metal-regulatory transcription factor 1 | 61 | 42 | 108 | 0.62 | 1 | 0.537 | 779 | view hsps |
| Public Clones | |||
| Private Clones | OST369434 (lexicon) OST148371 (lexicon) OST434965 (lexicon) OST394741 (lexicon) OST143138 (lexicon) OST190312 (lexicon) OST295500 (lexicon) OST179896 (lexicon) |
||