| TrapCLuster Report for TCL11047 |
| Internal ID | 11047 |
||||||||
| Accession | TCL11047 |
||||||||
| Sequence |
|
||||||||
| RNA length | 599 |
||||||||
| Overlapping | |||||||||
| Blocks | 1 |
||||||||
| Traps | 13 |
||||||||
| Distance from gene | 70079 |
||||||||
| Gene in slice | 0 |
||||||||
| Gene in slice (same strand) | 0 |
||||||||
| Human Conservation | 1 |
||||||||
| Dog Conservation | 1 |
||||||||
| Gallus Conservation | 0 |
||||||||
| Total Conservation | 1 |
||||||||
| LORF Length | 80 |
||||||||
| LORF-Blastp Result | 1 |
||||||||
| UTRscan Result | 0 |
||||||||
| Max UTR length | 0 |
||||||||
| Closest Gene (stable_id) | ENSMUSG00000062713 |
||||||||
| Closest Gene (name) | NP_035507.1 |
||||||||
| Close to OMIM | 0 |
||||||||
| Disease | 0 |
||||||||
| Go To Ensembl |  |
||||||||
| Go To UCSC |  |
| Sorry, no results for your search. |
| Longest ORF | Translation | Length | Strand |
| gaatttagcatccttttcctttctgatcctctcaaggtgc tttcagacagtgactgctttcttaatcaaatggtagaggc ctttggactgaaggaatctcaagattttattaccagtcac aaaacagacctgtgccacaccgtgggagtccctcaggatc acacctgtctgggagggagtcaggccttacttggccagct tgtcagtctgtcccttcatgtcctcagacatcagcgccaa t |
EFSILFLSDPLKVLSDSDCFLNQMVEAFGLKESQDFITSH KTDLCHTVGVPQDHTCLGGSQALLGQLVSLSLHVLRHQRQ |
80 | - |
| BLASTP Hit ID (ORF) | Description | Score | Start | End | Frac Aligned Query | Num Hsps | Frac Identical | Length | |
| UniRef90_UPI00004A6DF0 | Cluster related to UPI00004A6DF0; PREDICTED: hypothetical protein XP_549564 | 85 | 1 | 66 | 0.82 | 1 | 0.697 | 137 | view hsps |