| TrapCLuster Report for TCL11263 |
| Internal ID | 11263 |
|||||||||||||
| Accession | TCL11263 |
|||||||||||||
| Sequence |
|
|||||||||||||
| RNA length | 979 |
|||||||||||||
| Overlapping | ||||||||||||||
| Blocks | 2 |
|||||||||||||
| Traps | 9 |
|||||||||||||
| Distance from gene | 0 |
|||||||||||||
| Gene in slice | 1 |
|||||||||||||
| Gene in slice (same strand) | 1 |
|||||||||||||
| Human Conservation | 1 |
|||||||||||||
| Dog Conservation | 1 |
|||||||||||||
| Gallus Conservation | 1 |
|||||||||||||
| Total Conservation | 1 |
|||||||||||||
| LORF Length | 144 |
|||||||||||||
| LORF-Blastp Result | 1 |
|||||||||||||
| UTRscan Result | 0 |
|||||||||||||
| Max UTR length | 0 |
|||||||||||||
| Closest Gene (stable_id) | ENSMUSG00000060459 |
|||||||||||||
| Closest Gene (name) | Kng2 |
|||||||||||||
| Close to OMIM | 1 |
|||||||||||||
| Disease | [Kininogen deficiency] (3) |
|||||||||||||
| Go To Ensembl |  |
|||||||||||||
| Go To UCSC |  |
| Sorry, no results for your search. |
| Longest ORF | Translation | Length | Strand |
| ATGATCCCCAAGTTTTTACAGTTTTTCAAGCACAGGAGTC CCAAAATAAGGTCTCGTGCTGTTGCATGTGTCAATCAGTT CATCATCAGCCGGACCCAGGCGCTCATGCTGCACATGGAT TCCTTCATTGAGAACCTCTTTGCACTGGCTGGCGACGAGG AAGCAGAGGTGCGGAAGAACGTGTGCCGGGCGCTTGTGAT GTTGCTTGAAGCCCGGATGGACCGCCTGCTTCCTCATATG CACAACATAGTCGAGTACATGCTGCAGAGAACCCAAGACC AAGATGAGAATGTAGCTCTGGAGGCCTGTGAATTCTGGCT GACTTTGGCTGAACAGCCAATATGCAAAGATGTACTTGTA AGGCATCTACCAAAGTTGATTCCTGTGTTAGTGAATGGCA TGAAGTACTCAGATATAGATATTATCCTGCTTA |
MIPKFLQFFKHRSPKIRSRAVACVNQFIISRTQALMLHMD SFIENLFALAGDEEAEVRKNVCRALVMLLEARMDRLLPHM HNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLV RHLPKLIPVLVNGMKYSDIDIILL |
144 | + |
| BLASTP Hit ID (ORF) | Description | Score | Start | End | Frac Aligned Query | Num Hsps | Frac Identical | Length | |
| UniRef90_Q92973 | Transportin-1 (Importin beta-)2 related cluster | 279 | 1 | 144 | 1 | 1 | 0.965 | 890 | view hsps |
| UniRef90_UPI0000545E10 | Cluster related to UPI0000545E10; PREDICTED: similar to transportin 1 | 265 | 1 | 144 | 1 | 1 | 0.896 | 974 | view hsps |
| UniRef90_UPI000036132D | Cluster related to UPI000036132D | 254 | 1 | 144 | 1 | 1 | 0.882 | 763 | view hsps |
| UniRef90_UPI00004A4023 | Cluster related to UPI00004A4023; PREDICTED: similar to transportin 1 | 244 | 1 | 127 | 0.88 | 1 | 0.945 | 2147 | view hsps |
| UniRef90_UPI0000363990 | Cluster related to UPI0000363990 | 243 | 1 | 144 | 1 | 1 | 0.806 | 869 | view hsps |
| UniRef90_Q4T934 | Chromosome 3 SCAF7645, whole genome shotgun sequence related cluster | 243 | 1 | 144 | 1 | 1 | 0.806 | 1145 | view hsps |
| UniRef90_UPI0000363992 | Cluster related to UPI0000363992 | 243 | 1 | 144 | 1 | 1 | 0.806 | 783 | view hsps |
| UniRef90_UPI0000364967 | Cluster related to UPI0000364967 | 242 | 1 | 144 | 1 | 1 | 0.812 | 763 | view hsps |
| UniRef90_UPI0000515791 | Cluster related to UPI0000515791; similar to transportin 1; karyopherin (importin) beta 2 | 241 | 1 | 144 | 1 | 1 | 0.771 | 901 | view hsps |
| UniRef90_UPI0000494698 | Cluster related to UPI0000494698; PREDICTED: transportin 2 (importin 3, karyopherin beta 2b) | 239 | 1 | 144 | 1 | 1 | 0.799 | 977 | view hsps |
| UniRef90_O14787 | Transportin-2 related cluster | 239 | 1 | 144 | 1 | 1 | 0.799 | 897 | view hsps |
| UniRef90_Q99LG2 | Transportin-2 related cluster | 239 | 1 | 144 | 1 | 1 | 0.799 | 887 | view hsps |
| UniRef90_UPI00004D595B | Cluster related to UPI00004D595B | 235 | 1 | 144 | 1 | 1 | 0.792 | 871 | view hsps |
| UniRef90_UPI000058508B | Cluster related to UPI000058508B; PREDICTED: similar to transportin 1, partial | 234 | 1 | 144 | 1 | 1 | 0.771 | 735 | view hsps |
| UniRef90_Q5TRB1 | ENSANGP00000028987 related cluster | 229 | 1 | 144 | 1 | 1 | 0.757 | 904 | view hsps |
| UniRef90_Q4RZY5 | Chromosome 18 SCAF14786, whole genome shotgun sequence related cluster | 228 | 1 | 144 | 1 | 1 | 0.812 | 937 | view hsps |
| UniRef90_O76331 | Transportin related cluster | 217 | 1 | 144 | 1 | 1 | 0.729 | 893 | view hsps |
| UniRef90_UPI0000584953 | Cluster related to UPI0000584953; PREDICTED: similar to transportin 1 | 209 | 16 | 144 | 0.9 | 1 | 0.767 | 701 | view hsps |
| UniRef90_UPI00004EE112 | Cluster related to UPI00004EE112; PREDICTED: similar to Karyopherin (importin) beta 2b | 206 | 1 | 123 | 0.85 | 1 | 0.797 | 365 | view hsps |
| UniRef90_UPI00004D2D65 | Cluster related to UPI00004D2D65 | 204 | 1 | 144 | 1 | 1 | 0.75 | 811 | view hsps |
| UniRef90_Q4SQI2 | Chromosome 4 SCAF14533, whole genome shotgun sequence related cluster | 197 | 1 | 144 | 1 | 1 | 0.722 | 576 | view hsps |
| UniRef90_UPI0000449B46 | Cluster related to UPI0000449B46; PREDICTED: similar to transportin 1; karyopherin (importin) beta 2; importin beta 2; M9 region interaction protein | 193 | 37 | 144 | 0.75 | 1 | 0.889 | 1108 | view hsps |
| UniRef90_Q8MSM3 | AT21921p related cluster | 172 | 1 | 144 | 1 | 1 | 0.576 | 853 | view hsps |
| UniRef90_O14089 | Putative importin beta-2 subunit related cluster | 166 | 1 | 144 | 1 | 1 | 0.528 | 910 | view hsps |
| UniRef90_Q4P666 | Hypothetical protein related cluster | 152 | 1 | 144 | 1 | 1 | 0.5 | 924 | view hsps |
| UniRef90_O62332 | Hypothetical protein imb-2 related cluster | 139 | 1 | 140 | 0.97 | 1 | 0.421 | 883 | view hsps |
| UniRef90_Q55CQ7 | Hypothetical protein related cluster | 135 | 1 | 140 | 0.97 | 1 | 0.414 | 931 | view hsps |
| UniRef90_Q5KH73 | Importin beta-2 subunit, putative related cluster | 123 | 1 | 144 | 1 | 1 | 0.424 | 924 | view hsps |
| UniRef90_Q9ZVW8 | Putative transportin related cluster | 121 | 2 | 144 | 0.99 | 1 | 0.441 | 827 | view hsps |
| UniRef90_Q6BV45 | Similar to CA0199|CaKAP104 Candida albicans related cluster | 119 | 1 | 144 | 1 | 1 | 0.424 | 934 | view hsps |
| UniRef90_Q8H2D6 | Transportin related cluster | 119 | 2 | 144 | 0.99 | 1 | 0.448 | 894 | view hsps |
| UniRef90_Q9HE41 | Related to IMPORTIN BETA-2 SUBUNIT related cluster | 117 | 1 | 144 | 1 | 1 | 0.396 | 944 | view hsps |
| UniRef90_Q4WRL4 | Importin beta-2 subunit, putative related cluster | 117 | 1 | 144 | 1 | 1 | 0.389 | 937 | view hsps |
| UniRef90_Q4ILQ4 | Hypothetical protein related cluster | 113 | 1 | 144 | 1 | 1 | 0.389 | 944 | view hsps |
| UniRef90_Q5BEV4 | Hypothetical protein related cluster | 105 | 1 | 144 | 1 | 1 | 0.368 | 916 | view hsps |
| UniRef90_Q59ZG3 | Hypothetical protein KAP104 related cluster | 104 | 1 | 144 | 1 | 1 | 0.382 | 948 | view hsps |
| UniRef90_P38217 | Importin beta-2 subunit related cluster | 94 | 1 | 144 | 1 | 1 | 0.382 | 918 | view hsps |
| UniRef90_Q6C386 | Yarrowia lipolytica chromosome F of strain CLIB99 of Yarrowia lipolytica related cluster | 90 | 1 | 144 | 1 | 1 | 0.306 | 904 | view hsps |
| UniRef90_Q756N5 | AER219Cp related cluster | 90 | 1 | 144 | 1 | 1 | 0.361 | 909 | view hsps |
| UniRef90_Q6CUK1 | Similar to sgd|S0000221 Saccharomyces cerevisiae YBR017c KAP104 beta- karyopherin related cluster | 89 | 12 | 144 | 0.92 | 1 | 0.338 | 884 | view hsps |
| UniRef90_Q6FQQ0 | Similar to sp|P38217 Saccharomyces cerevisiae YBR017c KAP104 beta- karyopherin related cluster | 79 | 1 | 144 | 1 | 1 | 0.354 | 917 | view hsps |
| UniRef90_UPI000049408E | Cluster related to UPI000049408E; PREDICTED: hypothetical protein XP_523581 | 64 | 111 | 143 | 0.23 | 1 | 0.879 | 483 | view hsps |