| TrapCLuster Report for TCL12088 |
| Internal ID | 12088 |
||
| Accession | TCL12088 |
||
| Sequence |
|
||
| RNA length | 146 |
||
| Overlapping | |||
| Blocks | 1 |
||
| Traps | 1 |
||
| Distance from gene | 79209 |
||
| Gene in slice | 0 |
||
| Gene in slice (same strand) | 0 |
||
| Human Conservation | 0 |
||
| Dog Conservation | 0 |
||
| Gallus Conservation | 0 |
||
| Total Conservation | 0 |
||
| LORF Length | 45 |
||
| LORF-Blastp Result | 0 |
||
| UTRscan Result | 1 |
||
| Max UTR length | 14 |
||
| Closest Gene (stable_id) | ENSMUSG00000064748 |
||
| Closest Gene (name) | 5S_rRNA |
||
| Close to OMIM | 0 |
||
| Disease | 0 |
||
| Go To Ensembl |  |
||
| Go To UCSC |  |
| Sorry, no results for your search. |
| Longest ORF | Translation | Length | Strand |
| gtttacccctctactcaggcctactcagtcccctgcggga ctgtggaatttgcgagtcagagtgggaagcccaagggagt cagaagaccccatcttgtcctaattgaggcaattcagggg agaaaacagacctctt |
VYPSTQAYSVPCGTVEFASQSGKPKGVRRPHLVLIEAIQG RKQTS |
45 | + |
| BLASTP Hit ID (ORF) | Description | Score | Start | End | Frac Aligned Query | Num Hsps | Frac Identical | Length | |
| No BLASTP result for Longest-ORF! | |||||||||
| Public Clones | |||
| Private Clones | OST345730 (lexicon) | ||