TrapCLuster Report for TCL17349

Internal ID  
17349
 
Accession  
TCL17349
 
Sequence  
catcaacaacgctgagaagagaggcaaacgccaggtcctcatcaggccatgttctaagtcatcgttcggttcttaaccgt
 
gatgatgaagcacggatacattggtgaattcgagatcattgatgatcacagagctgggaagattgttgtgaacctcacag
 
gaaggttgaacaagtgtggcgttataagccctagatttgatgttcaactcaaagacctagagaaatggcagaacaacctg
 
ctcccttcacgtcagtttggcttcattgtgctgacaacctcggctggcattatggaccatgaagaggcaagacgaaaaca
 
tagaggagggaaaatcctgggattctttttttaaatgtaaagcataaataaaaagcctttgtggactgtg
 
RNA length  
390
 
Overlapping 
 
Blocks  
1
 
Traps  
1
 
Distance from gene  
70317
 
Gene in slice  
0
 
Gene in slice (same strand)  
0
 
Human Conservation  
1
 
Dog Conservation  
1
 
Gallus Conservation  
1
 
Total Conservation  
1
 
LORF Length  
90
 
LORF-Blastp Result  
1
 
UTRscan Result  
0
 
Max UTR length  
0
 
Closest Gene (stable_id)  
ENSMUSG00000068081
 
Closest Gene (name) 
 
Close to OMIM  
0
 
Disease  
0
 
Go To Ensembl 
Go To UCSC 

Sorry, no results for your search.

Longest ORF Translation Length Strand
atgatgaagcacggatacattggtgaattcgagatcattg
atgatcacagagctgggaagattgttgtgaacctcacagg
aaggttgaacaagtgtggcgttataagccctagatttgat
gttcaactcaaagacctagagaaatggcagaacaacctgc
tcccttcacgtcagtttggcttcattgtgctgacaacctc
ggctggcattatggaccatgaagaggcaagacgaaaacat
agaggagggaaaatcctgggattcttttttt
 MMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRFD
VQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH
RGGKILGFFF
 90 +

BLASTP Hit ID (ORF) Description Score Start End Frac Aligned Query Num Hsps Frac Identical Length  
UniRef90_P62244 40S ribosomal protein S15a related cluster 186 1 90 1 1 0.989 129 view hsps
UniRef90_UPI00004F04A1 Cluster related to UPI00004F04A1; PREDICTED: similar to FLJ16636 protein, partial 186 1 90 1 1 0.989 683 view hsps
UniRef90_UPI0000493DDD Cluster related to UPI0000493DDD; PREDICTED: similar to Rps15a protein 186 1 90 1 1 0.989 151 view hsps
UniRef90_Q90YQ8 40S ribosomal protein S15a related cluster 183 1 90 1 1 0.978 129 view hsps
UniRef90_UPI00004A5DA0 Cluster related to UPI00004A5DA0; PREDICTED: similar to ribosomal protein S15a 182 1 89 0.99 1 0.966 138 view hsps
UniRef90_UPI00004A5BB6 Cluster related to UPI00004A5BB6; PREDICTED: hypothetical protein XP_532791 179 1 90 1 1 0.956 131 view hsps
UniRef90_UPI000049074A Cluster related to UPI000049074A; PREDICTED: similar to Rps15a protein 179 1 90 1 1 0.956 149 view hsps
UniRef90_UPI00004A3F87 Cluster related to UPI00004A3F87; PREDICTED: similar to Rps15a protein 176 1 90 1 1 0.944 283 view hsps
UniRef90_UPI00004EEBC0 Cluster related to UPI00004EEBC0; PREDICTED: similar to Rps15a protein, partial 174 1 90 1 1 0.933 149 view hsps
UniRef90_UPI00004F0FDD Cluster related to UPI00004F0FDD; PREDICTED: similar to Rps15a protein 173 1 90 1 1 0.933 147 view hsps
UniRef90_P48149 40S ribosomal protein S15Aa related cluster 172 1 90 1 1 0.878 129 view hsps
UniRef90_Q7KR04 40S ribosomal protein S15Ab related cluster 171 1 90 1 1 0.867 129 view hsps
UniRef90_UPI0000512075 Cluster related to UPI0000512075; PREDICTED: similar to Rps15a protein 170 1 90 1 1 0.911 294 view hsps
UniRef90_UPI00004A5462 Cluster related to UPI00004A5462; PREDICTED: similar to Rps15a protein 168 1 90 1 1 0.911 233 view hsps
UniRef90_UPI00004918FB Cluster related to UPI00004918FB; PREDICTED: similar to ribosomal protein S15a 167 1 90 1 1 0.889 144 view hsps
UniRef90_UPI000056662C Cluster related to UPI000056662C; PREDICTED: similar to ribosomal protein S15a 166 1 90 1 1 0.867 130 view hsps
UniRef90_Q5QBH8 Ribosomal protein S15 related cluster 166 1 90 1 1 0.844 130 view hsps
UniRef90_P50891 40S ribosomal protein S15a related cluster 166 1 90 1 1 0.822 129 view hsps
UniRef90_Q8T5T2 Ribosomal protein S24 related cluster 165 1 90 1 1 0.844 130 view hsps
UniRef90_Q7PMI3 ENSANGP00000021108 related cluster 165 1 90 1 1 0.822 130 view hsps
UniRef90_Q8I7X5 Ribosomal protein S15a related cluster 164 1 90 1 1 0.833 130 view hsps
UniRef90_UPI00001CB74E Cluster related to UPI00001CB74E; similar to Rps15a protein 164 1 90 1 1 0.867 127 view hsps
UniRef90_UPI000013E925 Cluster related to UPI000013E925 162 1 90 1 1 0.867 129 view hsps
UniRef90_UPI000050158B Cluster related to UPI000050158B; similar to 40S ribosomal protein S15a 160 3 89 0.97 1 0.874 130 view hsps
UniRef90_O17218 Ribosomal protein, small subunit protein 22 related cluster 160 1 90 1 1 0.833 130 view hsps
UniRef90_Q5MGL9 Ribosomal protein S8 related cluster 159 1 87 0.97 1 0.862 131 view hsps
UniRef90_Q4KTC6 S15a related cluster 157 1 90 1 1 0.8 130 view hsps
UniRef90_UPI00004F266F Cluster related to UPI00004F266F; PREDICTED: similar to ribosomal protein S15a, partial 157 1 89 0.99 1 0.843 108 view hsps
UniRef90_UPI0000514D9B Cluster related to UPI0000514D9B 156 5 90 0.96 1 0.849 107 view hsps
UniRef90_UPI0000494AC2 Cluster related to UPI0000494AC2; PREDICTED: similar to ribosomal protein S15a 156 1 90 1 1 0.844 143 view hsps
UniRef90_UPI00004926A9 Cluster related to UPI00004926A9; PREDICTED: similar to FKSG89 155 1 77 0.86 1 0.974 614 view hsps
UniRef90_Q5DH03 Hypothetical protein related cluster 154 1 90 1 1 0.778 130 view hsps
UniRef90_Q4N673 40S ribosomal protein S15a, putative related cluster 153 1 90 1 1 0.744 130 view hsps
UniRef90_P42798 40S ribosomal protein S15a related cluster 153 1 90 1 1 0.789 129 view hsps
UniRef90_Q4QGW3 40S ribosomal protein S15a, putative related cluster 153 1 90 1 1 0.778 130 view hsps
UniRef90_P04648 40S ribosomal protein S22 related cluster 153 1 90 1 1 0.778 129 view hsps
UniRef90_Q6C0E7 Yarrowia lipolytica chromosome F of strain CLIB99 of Yarrowia lipolytica related cluster 152 1 90 1 1 0.767 130 view hsps
UniRef90_UPI0000490A5E Cluster related to UPI0000490A5E; PREDICTED: similar to ribosomal protein S15a 151 1 90 1 1 0.811 307 view hsps
UniRef90_Q4WRN1 Ribosomal protein S8 related cluster 150 1 90 1 1 0.756 130 view hsps
UniRef90_Q7RV75 40S ribosomal protein S22 related cluster 149 1 90 1 1 0.744 130 view hsps
UniRef90_Q4PG96 Hypothetical protein related cluster 148 1 90 1 1 0.733 130 view hsps
UniRef90_UPI00004A7868 Cluster related to UPI00004A7868; PREDICTED: similar to Rps15a protein 147 1 90 1 1 0.822 141 view hsps
UniRef90_O80646 40S ribosomal protein S15A related cluster 145 1 90 1 1 0.733 136 view hsps
UniRef90_Q6XZG0 Ribosomal S15a protein related cluster 145 1 90 1 1 0.722 130 view hsps
UniRef90_P46793 40S ribosomal protein S15a related cluster 145 1 90 1 1 0.733 129 view hsps
UniRef90_Q6CW06 Kluyveromyces lactis strain NRRL Y-1140 chromosome B of strain NRRL Y- 1140 of Kluyveromyces lactis related cluster 144 5 90 0.96 1 0.767 104 view hsps
UniRef90_Q9UUP9 Ribosomal protein 22 of the small subunit related cluster 143 1 90 1 1 0.722 130 view hsps
UniRef90_UPI00004949BA Cluster related to UPI00004949BA; PREDICTED: similar to ribosomal protein S15a 142 1 90 1 1 0.822 112 view hsps
UniRef90_O14469 40S ribosomal protein S22 related cluster 142 1 90 1 1 0.744 130 view hsps
UniRef90_Q5CVE5 40S ribosomal protein S15A , transcript identified by EST related cluster 141 1 90 1 1 0.733 137 view hsps
UniRef90_O77395 40S ribosomal protein S15A, putative related cluster 139 1 90 1 1 0.711 130 view hsps
UniRef90_Q5K979 Ribosomal protein 22 of the small subunit, putative related cluster 138 1 90 1 1 0.711 130 view hsps
UniRef90_UPI0000511B45 Cluster related to UPI0000511B45; PREDICTED: similar to Rps15a protein 137 1 66 0.73 1 0.985 162 view hsps
UniRef90_UPI00004A7513 Cluster related to UPI00004A7513; PREDICTED: similar to Rps15a protein 137 1 90 1 1 0.767 402 view hsps
UniRef90_P46792 40S ribosomal protein S22 related cluster 135 1 90 1 1 0.711 130 view hsps
UniRef90_UPI0000493FE2 Cluster related to UPI0000493FE2; PREDICTED: hypothetical protein XP_523505 135 1 90 1 1 0.756 129 view hsps
UniRef90_Q76KS7 Ribosomal protein S15a related cluster 133 1 90 1 1 0.689 130 view hsps
UniRef90_Q4HWY1 Hypothetical protein related cluster 133 1 90 1 1 0.711 130 view hsps
UniRef90_Q515N0 40S ribosomal protein S15a, putative related cluster 132 1 90 1 1 0.667 130 view hsps
UniRef90_UPI00004A492E Cluster related to UPI00004A492E; PREDICTED: similar to Hypothetical protein HSPC111 129 1 63 0.7 1 0.968 441 view hsps
UniRef90_Q76KS2 Ribosomal protein S15a related cluster 126 1 90 1 1 0.622 130 view hsps
UniRef90_Q9AVX4 40S ribosomal protein S15A related cluster 123 1 90 1 1 0.622 130 view hsps
UniRef90_UPI00005042E3 Cluster related to UPI00005042E3 123 1 90 1 1 0.7 120 view hsps
UniRef90_UPI00004D3DA5 Cluster related to UPI00004D3DA5 122 30 90 0.68 1 0.934 130 view hsps
UniRef90_UPI00004EE93A Cluster related to UPI00004EE93A; PREDICTED: similar to ribosomal protein S15a 122 1 77 0.86 1 0.818 107 view hsps
UniRef90_UPI00004EF2D0 Cluster related to UPI00004EF2D0; PREDICTED: similar to ribosomal protein S15a, partial 117 28 90 0.7 1 0.889 98 view hsps
UniRef90_Q9V1V0 30S ribosomal protein S8P related cluster 103 1 90 1 1 0.489 130 view hsps
UniRef90_Q8SQL9 40S RIBOSOMAL PROTEIN S15A related cluster 102 1 90 1 1 0.489 128 view hsps
UniRef90_Q6EN44 Putative 40S ribosomal protein S15A related cluster 99 1 89 0.99 1 0.483 129 view hsps
UniRef90_Q8TW15 30S ribosomal protein S8P related cluster 99 1 90 1 1 0.467 130 view hsps
UniRef90_Q977V0 30S ribosomal protein S8P related cluster 99 1 90 1 1 0.478 130 view hsps
UniRef90_O26126 30S ribosomal protein S8P related cluster 99 1 90 1 1 0.478 133 view hsps
UniRef90_P54041 30S ribosomal protein S8P related cluster 98 1 90 1 1 0.467 130 view hsps
UniRef90_Q975J5 30S ribosomal protein S8P related cluster 97 1 90 1 1 0.5 133 view hsps
UniRef90_Q673R3 Ribosomal protein S8 related cluster 96 1 90 1 1 0.422 129 view hsps
UniRef90_Q8TRT2 30S ribosomal protein S8P related cluster 96 1 90 1 1 0.467 130 view hsps
UniRef90_Q64BF2 SSU ribosomal protein S8P related cluster 95 1 90 1 1 0.456 130 view hsps
UniRef90_Q977U8 30S ribosomal protein S8P related cluster 93 1 90 1 1 0.422 130 view hsps
UniRef90_O82205 40S ribosomal protein S15A related cluster 93 1 89 0.99 1 0.461 129 view hsps
UniRef90_O05636 30S ribosomal protein S8P related cluster 92 1 90 1 1 0.5 133 view hsps
UniRef90_Q9UX92 30S ribosomal protein S8P related cluster 92 1 90 1 1 0.5 133 view hsps
UniRef90_Q8ZVW0 30S ribosomal protein S8P related cluster 91 1 90 1 1 0.389 130 view hsps
UniRef90_Q6LXD8 30S ribosomal protein S8P related cluster 89 1 90 1 1 0.411 130 view hsps
UniRef90_UPI00004192D5 Cluster related to UPI00004192D5; PREDICTED: similar to Rps15a protein 89 48 90 0.48 1 0.953 202 view hsps
UniRef90_Q6L1B2 Small subunit ribosomal protein S8P related cluster 89 1 90 1 1 0.433 129 view hsps
UniRef90_Q9HIS2 30S ribosomal protein S8P related cluster 87 1 90 1 1 0.433 129 view hsps
UniRef90_O28369 30S ribosomal protein S8P related cluster 87 1 90 1 1 0.378 131 view hsps
UniRef90_P12742 30S ribosomal protein S8P related cluster 87 5 90 0.96 1 0.419 129 view hsps
UniRef90_Q9HPB9 30S ribosomal protein S8P related cluster 86 5 90 0.96 1 0.419 130 view hsps
UniRef90_UPI000054218A Cluster related to UPI000054218A; Ribosomal protein S8 84 1 90 1 1 0.411 129 view hsps
UniRef90_UPI00004A420B Cluster related to UPI00004A420B; PREDICTED: similar to RIKEN cDNA 2610033H07 79 2 42 0.46 1 0.878 1196 view hsps
UniRef90_UPI000041AA97 Cluster related to UPI000041AA97; PREDICTED: similar to ribosomal protein S15 isoform 77 1 40 0.44 1 0.85 323 view hsps
UniRef90_Q9YF89 30S ribosomal protein S8P related cluster 77 3 90 0.98 1 0.443 135 view hsps
UniRef90_UPI00004F3C40 Cluster related to UPI00004F3C40; PREDICTED: similar to ribosomal protein S15a, partial 71 1 90 1 1 0.467 96 view hsps
UniRef90_Q74NG1 NEQ274 related cluster 68 1 90 1 1 0.322 129 view hsps
UniRef90_UPI00004BEC66 Cluster related to UPI00004BEC66 66 1 40 0.44 1 0.775 79 view hsps
UniRef90_UPI0000507EC3 Cluster related to UPI0000507EC3; PREDICTED: similar to ribosomal protein L21 53 8 81 0.82 1 0.432 237 view hsps

Public Clones  
Private Clones OST216379 (lexicon)