| TrapCLuster Report for TCL26550 |
| Internal ID | 26550 |
|||
| Accession | TCL26550 |
|||
| Sequence |
|
|||
| RNA length | 194 |
|||
| Overlapping | ||||
| Blocks | 1 |
|||
| Traps | 3 |
|||
| Distance from gene | 182010 |
|||
| Gene in slice | 1 |
|||
| Gene in slice (same strand) | 0 |
|||
| Human Conservation | 1 |
|||
| Dog Conservation | 1 |
|||
| Gallus Conservation | 1 |
|||
| Total Conservation | 1 |
|||
| LORF Length | 64 |
|||
| LORF-Blastp Result | 0 |
|||
| UTRscan Result | 0 |
|||
| Max UTR length | 0 |
|||
| Closest Gene (stable_id) | ENSMUSG00000061787 |
|||
| Closest Gene (name) | Rps17 |
|||
| Close to OMIM | 0 |
|||
| Disease | 0 |
|||
| Go To Ensembl |  |
|||
| Go To UCSC |  |
| Sorry, no results for your search. |
| Longest ORF | Translation | Length | Strand |
| ttttgtttctttgtccaagtttatgtacaccttagggtgg cccagggcaccaccgcctccatcgcaggctatgatacgat ggtccacctcattcacaggctgttgtgctatcaaatcaat ggcaaagttctcattcacctctttctgacgatctacaaaa cgaatcctcctgtagtctttttcatcatacacc |
FCFFVQVYVHLRVAQGTTASIAGYDTMVHLIHRLLCYQIN GKVLIHLFLTIYKTNPPVVFFIIH |
64 | - |
| BLASTP Hit ID (ORF) | Description | Score | Start | End | Frac Aligned Query | Num Hsps | Frac Identical | Length | |
| No BLASTP result for Longest-ORF! | |||||||||
| Public Clones | |||
| Private Clones | OST248107 (lexicon) OST65649 (lexicon) OST345232 (lexicon) | ||