| TrapCLuster Report for TCL27711 |
| Internal ID | 27711 |
|||||
| Accession | TCL27711 |
|||||
| Sequence |
|
|||||
| RNA length | 391 |
|||||
| Overlapping | ||||||
| Blocks | 3 |
|||||
| Traps | 1 |
|||||
| Distance from gene | 38447 |
|||||
| Gene in slice | 0 |
|||||
| Gene in slice (same strand) | 0 |
|||||
| Human Conservation | 1 |
|||||
| Dog Conservation | 0 |
|||||
| Gallus Conservation | 0 |
|||||
| Total Conservation | 1 |
|||||
| LORF Length | 71 |
|||||
| LORF-Blastp Result | 0 |
|||||
| UTRscan Result | 1 |
|||||
| Max UTR length | 8 |
|||||
| Closest Gene (stable_id) | ENSMUSG00000025318 |
|||||
| Closest Gene (name) | Jph3 |
|||||
| Close to OMIM | 0 |
|||||
| Disease | 0 |
|||||
| Go To Ensembl |  |
|||||
| Go To UCSC |  |
| Sorry, no results for your search. |
| Longest ORF | Translation | Length | Strand |
| aggttgttcaaagcagagattttagtaataatacaccttc aagttggaagcagctggcagctcaaatccacaccgagtgg tgcagcgataaatgagggacgacggtctgtttgcacacag agaattCTTGGTTCCTTTGGCCGATGTCTTCATATGTTTA TCTGTCTGGATAGAAGAAAGCCTGCTCTCTGGTGTGCCTC CTGTGGCCTAAAAT |
RLFKAEILVIIHLQVGSSWQLKSTPSGAAINEGRRSVCTQ RILGSFGRCLHMFICLDRRKPALWCASCGLK |
71 | - |
| BLASTP Hit ID (ORF) | Description | Score | Start | End | Frac Aligned Query | Num Hsps | Frac Identical | Length | |
| No BLASTP result for Longest-ORF! | |||||||||
| Public Clones | |||
| Private Clones | OST98957 (lexicon) | ||