| TrapCLuster Report for TCL4056 |
| Internal ID | 4056 |
||||
| Accession | TCL4056 |
||||
| Sequence |
|
||||
| RNA length | 316 |
||||
| Overlapping | |||||
| Blocks | 1 |
||||
| Traps | 1 |
||||
| Distance from gene | 14675 |
||||
| Gene in slice | 0 |
||||
| Gene in slice (same strand) | 0 |
||||
| Human Conservation | 0 |
||||
| Dog Conservation | 1 |
||||
| Gallus Conservation | 0 |
||||
| Total Conservation | 1 |
||||
| LORF Length | 105 |
||||
| LORF-Blastp Result | 0 |
||||
| UTRscan Result | 0 |
||||
| Max UTR length | 0 |
||||
| Closest Gene (stable_id) | ENSMUSG00000018379 |
||||
| Closest Gene (name) | Sfrs1 |
||||
| Close to OMIM | 0 |
||||
| Disease | 0 |
||||
| Go To Ensembl |  |
||||
| Go To UCSC |  |
| Internal Id | Chromosome | Start | End | Strand | Release |
2637 |
17 |
26353912 |
26354111 |
1 |
NCBIM34 |
| Longest ORF | Translation | Length | Strand |
| cctacctttcaggaagccctcccccagatctcatctggga aacaggctcaggaaggactaaaggatagtctcaggttctg cacggcccaagttttcaaaccagctcatagctcagctctt ccttctggaagtctccagcaatgtttcagtctgcactttg agaagaggagcccttgttacctgccaccttctcacaccat cccctggggatgctcccaggaaacaggaacaactccctcc cctctcccagggtaccatgcagggatgcacccaggctttc agaacttgactgaaaagaacgttttaggtctttctg |
PTFQEALPQISSGKQAQEGLKDSLRFCTAQVFKPAHSSAL PSGSLQQCFSLHFEKRSPCYLPPSHTIPWGCSQETGTTPS PLPGYHAGMHPGFQNLTEKNVLGLS |
105 | + |
| BLASTP Hit ID (ORF) | Description | Score | Start | End | Frac Aligned Query | Num Hsps | Frac Identical | Length | |
| No BLASTP result for Longest-ORF! | |||||||||
| Public Clones | |||
| Private Clones | OST404753 (lexicon) | ||