| TrapCLuster Report for TCL4057 |
| Internal ID | 4057 |
||||
| Accession | TCL4057 |
||||
| Sequence |
|
||||
| RNA length | 313 |
||||
| Overlapping | |||||
| Blocks | 1 |
||||
| Traps | 5 |
||||
| Distance from gene | 213 |
||||
| Gene in slice | 0 |
||||
| Gene in slice (same strand) | 0 |
||||
| Human Conservation | 1 |
||||
| Dog Conservation | 1 |
||||
| Gallus Conservation | 0 |
||||
| Total Conservation | 1 |
||||
| LORF Length | 89 |
||||
| LORF-Blastp Result | 0 |
||||
| UTRscan Result | 0 |
||||
| Max UTR length | 0 |
||||
| Closest Gene (stable_id) | ENSMUSG00000018379 |
||||
| Closest Gene (name) | Sfrs1 |
||||
| Close to OMIM | 0 |
||||
| Disease | 0 |
||||
| Go To Ensembl |  |
||||
| Go To UCSC |  |
| Internal Id | Chromosome | Start | End | Strand | Release |
2687 |
17 |
26598958 |
26601584 |
1 |
NCBIM34 |
| Longest ORF | Translation | Length | Strand |
| atgaaatcacctgcaactcccgccggcggcaccgaagtgc agaagatgcccaggtttccggagcaacagctcagcgtcat ctatctccgccccgcggcgcctttcccgccaaaggccgtt accaccgcggagcatggtgggacacgcttgcaagataggt ttcacccaatctttttagagcgccgagctgctttcagaga gggtctacccccgaggtggccgacgattctggactcagtg gggattaataataaccgctttaaccaga |
MKSPATPAGGTEVQKMPRFPEQQLSVIYLRPAAPFPPKAV TTAEHGGTRLQDRFHPIFLERRAAFREGLPPRWPTILDSV GINNNRFNQ |
89 | + |
| BLASTP Hit ID (ORF) | Description | Score | Start | End | Frac Aligned Query | Num Hsps | Frac Identical | Length | |
| No BLASTP result for Longest-ORF! | |||||||||
| Public Clones | |||
| Private Clones | OST260166 (lexicon) OST115825 (lexicon) OST397404 (lexicon) OST108670 (lexicon) OST144256 (lexicon) |
||