| TrapCLuster Report for TCL4220 |
| Internal ID | 4220 |
||
| Accession | TCL4220 |
||
| Sequence |
|
||
| RNA length | 159 |
||
| Overlapping | |||
| Blocks | 1 |
||
| Traps | 2 |
||
| Distance from gene | 1594 |
||
| Gene in slice | 0 |
||
| Gene in slice (same strand) | 0 |
||
| Human Conservation | 0 |
||
| Dog Conservation | 0 |
||
| Gallus Conservation | 0 |
||
| Total Conservation | 0 |
||
| LORF Length | 52 |
||
| LORF-Blastp Result | 0 |
||
| UTRscan Result | 1 |
||
| Max UTR length | 8 |
||
| Closest Gene (stable_id) | ENSMUSG00000069741 |
||
| Closest Gene (name) | |||
| Close to OMIM | 0 |
||
| Disease | 0 |
||
| Go To Ensembl |  |
||
| Go To UCSC |  |
| Internal Id | Chromosome | Start | End | Strand | Release |
955 |
2 |
32095176 |
32095340 |
1 |
NCBIM34 |
| Longest ORF | Translation | Length | Strand |
| tcaattcatctcctttatctacaattcattggagggcagg gggtacaagataaccttccagggtacagattagtccaaat cacaggattctctgttcacgatggatgtcaacttcctttt caatcagttgtcacactttcatgtcctcaccctgttc |
SIHLLYLQFIGGQGVQDNLPGYRLVQITGFSVHDGCQLPF QSVVTLSCPHPV |
52 | - |
| BLASTP Hit ID (ORF) | Description | Score | Start | End | Frac Aligned Query | Num Hsps | Frac Identical | Length | |
| No BLASTP result for Longest-ORF! | |||||||||
| Public Clones | |||
| Private Clones | OST124106 (lexicon) OST173005 (lexicon) | ||