| TrapCLuster Report for TCL4668 |
| Internal ID | 4668 |
|||
| Accession | TCL4668 |
|||
| Sequence |
|
|||
| RNA length | 231 |
|||
| Overlapping | ||||
| Blocks | 1 |
|||
| Traps | 1 |
|||
| Distance from gene | 22998 |
|||
| Gene in slice | 0 |
|||
| Gene in slice (same strand) | 0 |
|||
| Human Conservation | 0 |
|||
| Dog Conservation | 0 |
|||
| Gallus Conservation | 0 |
|||
| Total Conservation | 0 |
|||
| LORF Length | 41 |
|||
| LORF-Blastp Result | 0 |
|||
| UTRscan Result | 0 |
|||
| Max UTR length | 0 |
|||
| Closest Gene (stable_id) | ENSMUSG00000041961 |
|||
| Closest Gene (name) | Q5SSZ7_MOUSE |
|||
| Close to OMIM | 0 |
|||
| Disease | 0 |
|||
| Go To Ensembl |  |
|||
| Go To UCSC |  |
| Internal Id | Chromosome | Start | End | Strand | Release |
3245 |
6 |
138408238 |
138408437 |
-1 |
NCBIM34 |
| Longest ORF | Translation | Length | Strand |
| gtgttcctctcaagattttccacatgcttccatgtgtgca tgagcaagaatttccccgggcaaacacaggtaggaaaaca acccagaactgatggggttgcaactagatacagcttgggc ttgt |
VFLSRFSTCFHVCMSKNFPGQTQVGKQPRTDGVATRYSLG L |
41 | + |
| BLASTP Hit ID (ORF) | Description | Score | Start | End | Frac Aligned Query | Num Hsps | Frac Identical | Length | |
| No BLASTP result for Longest-ORF! | |||||||||
| Public Clones | |||
| Private Clones | OST287687 (lexicon) | ||