| TrapCLuster Report for TCL4669 |
| Internal ID | 4669 |
||||
| Accession | TCL4669 |
||||
| Sequence |
|
||||
| RNA length | 318 |
||||
| Overlapping | |||||
| Blocks | 1 |
||||
| Traps | 7 |
||||
| Distance from gene | 22771 |
||||
| Gene in slice | 0 |
||||
| Gene in slice (same strand) | 0 |
||||
| Human Conservation | 0 |
||||
| Dog Conservation | 0 |
||||
| Gallus Conservation | 0 |
||||
| Total Conservation | 0 |
||||
| LORF Length | 75 |
||||
| LORF-Blastp Result | 0 |
||||
| UTRscan Result | 0 |
||||
| Max UTR length | 0 |
||||
| Closest Gene (stable_id) | ENSMUSG00000020482 |
||||
| Closest Gene (name) | BC018601 |
||||
| Close to OMIM | 0 |
||||
| Disease | 0 |
||||
| Go To Ensembl |  |
||||
| Go To UCSC |  |
| Internal Id | Chromosome | Start | End | Strand | Release |
3292 |
6 |
145903301 |
145903396 |
-1 |
NCBIM34 |
| Longest ORF | Translation | Length | Strand |
| ggatttattctctgccgcggctgggagtggacacctttgt tcagcaaaatgaaccttttcctgattgtgcacttccaggc cctgggcaagccgactctagcactctgcaaaaccccacct cccaaaggagggttgaacttcttggaacccttaaaaacta ccagtgaacttcaggaagtaacccacgcaactctttccca gaagaggtcaatggtcacagaatcgt |
GFILCRGWEWTPLFSKMNLFLIVHFQALGKPTLALCKTPP PKGGLNFLEPLKTTSELQEVTHATLSQKRSMVTES |
75 | - |
| BLASTP Hit ID (ORF) | Description | Score | Start | End | Frac Aligned Query | Num Hsps | Frac Identical | Length | |
| No BLASTP result for Longest-ORF! | |||||||||
| Public Clones | |||
| Private Clones | OST179750 (lexicon) OST68529 (lexicon) OST55499 (lexicon) OST182435 (lexicon) OST110450 (lexicon) OST339214 (lexicon) OST437602 (lexicon) |
||