| TrapCLuster Report for TCL4671 |
| Internal ID | 4671 |
||||||
| Accession | TCL4671 |
||||||
| Sequence |
|
||||||
| RNA length | 406 |
||||||
| Overlapping | |||||||
| Blocks | 1 |
||||||
| Traps | 2 |
||||||
| Distance from gene | 11051 |
||||||
| Gene in slice | 0 |
||||||
| Gene in slice (same strand) | 0 |
||||||
| Human Conservation | 1 |
||||||
| Dog Conservation | 1 |
||||||
| Gallus Conservation | 0 |
||||||
| Total Conservation | 1 |
||||||
| LORF Length | 59 |
||||||
| LORF-Blastp Result | 0 |
||||||
| UTRscan Result | 0 |
||||||
| Max UTR length | 0 |
||||||
| Closest Gene (stable_id) | ENSMUSG00000020482 |
||||||
| Closest Gene (name) | BC018601 |
||||||
| Close to OMIM | 0 |
||||||
| Disease | 0 |
||||||
| Go To Ensembl |  |
||||||
| Go To UCSC |  |
| Internal Id | Chromosome | Start | End | Strand | Release |
3386 |
6 |
149218451 |
149218795 |
-1 |
NCBIM34 |
| Longest ORF | Translation | Length | Strand |
| aggcgagtgtcctctaagcagccacatctccggcgctttg tggcttgtctaagatctcctaagagacagtgtctcttctg tgggttcagaccatcgaccccccgccccttttctttgatt tgtcttttgactctgtattttgcttgcttgtcactgcttc ttacatgtcacagaagct |
RRVSSKQPHLRRFVACLRSPKRQCLFCGFRPSTPRPFSLI CLLTLYFACLSLLLTCHRS |
59 | - |
| BLASTP Hit ID (ORF) | Description | Score | Start | End | Frac Aligned Query | Num Hsps | Frac Identical | Length | |
| No BLASTP result for Longest-ORF! | |||||||||
| Public Clones | |||
| Private Clones | OST148247 (lexicon) OST394919 (lexicon) | ||