| TrapCLuster Report for TCL4832 |
| Internal ID | 4832 |
|||
| Accession | TCL4832 |
|||
| Sequence |
|
|||
| RNA length | 166 |
|||
| Overlapping | ||||
| Blocks | 1 |
|||
| Traps | 1 |
|||
| Distance from gene | 27315 |
|||
| Gene in slice | 1 |
|||
| Gene in slice (same strand) | 0 |
|||
| Human Conservation | 1 |
|||
| Dog Conservation | 1 |
|||
| Gallus Conservation | 0 |
|||
| Total Conservation | 1 |
|||
| LORF Length | 47 |
|||
| LORF-Blastp Result | 0 |
|||
| UTRscan Result | 0 |
|||
| Max UTR length | 0 |
|||
| Closest Gene (stable_id) | ENSMUSG00000058896 |
|||
| Closest Gene (name) | ||||
| Close to OMIM | 0 |
|||
| Disease | 0 |
|||
| Go To Ensembl |  |
|||
| Go To UCSC |  |
| Internal Id | Chromosome | Start | End | Strand | Release |
1523 |
9 |
108617070 |
108617182 |
1 |
NCBIM34 |
| Longest ORF | Translation | Length | Strand |
| atgtccggttattgtaacttgctgtcagtgtgtcttcttt ccttctggtcctgggaagtttactgtgctctgccctctgg agagggagggagtcacagacgatgcattctgcagttgact aggagacaccagggagtacgag |
MSGYCNLLSVCLLSFWSWEVYCALPSGEGGSHRRCILQLT RRHQGVR |
47 | - |
| BLASTP Hit ID (ORF) | Description | Score | Start | End | Frac Aligned Query | Num Hsps | Frac Identical | Length | |
| No BLASTP result for Longest-ORF! | |||||||||
| Public Clones | |||
| Private Clones | OST329393 (lexicon) | ||