| TrapCLuster Report for TCL9295 |
| Internal ID | 9295 |
||
| Accession | TCL9295 |
||
| Sequence |
|
||
| RNA length | 122 |
||
| Overlapping | |||
| Blocks | 1 |
||
| Traps | 1 |
||
| Distance from gene | 324731 |
||
| Gene in slice | 0 |
||
| Gene in slice (same strand) | 0 |
||
| Human Conservation | 0 |
||
| Dog Conservation | 0 |
||
| Gallus Conservation | 0 |
||
| Total Conservation | 0 |
||
| LORF Length | 40 |
||
| LORF-Blastp Result | 0 |
||
| UTRscan Result | 0 |
||
| Max UTR length | 0 |
||
| Closest Gene (stable_id) | ENSMUSG00000039801 |
||
| Closest Gene (name) | 2410089E03Rik |
||
| Close to OMIM | 0 |
||
| Disease | 0 |
||
| Go To Ensembl |  |
||
| Go To UCSC |  |
| Internal Id | Chromosome | Start | End | Strand | Release |
9295 |
7 |
38399410 |
38399554 |
-1 |
NCBIM34 |
| Longest ORF | Translation | Length | Strand |
| gacagggctaagcactgtacctatggacctcagagacttg gagccagcttctctcaccacttggaccattcttcctcaat atggctacacatgctgatgaataaacaaacctgctcctac a |
DRAKHCTYGPQRLGASFSHHLDHSSSIWLHMLMNKQTCSY |
40 | + |
| BLASTP Hit ID (ORF) | Description | Score | Start | End | Frac Aligned Query | Num Hsps | Frac Identical | Length | |
| No BLASTP result for Longest-ORF! | |||||||||
| Public Clones | |||
| Private Clones | OST12515 (lexicon) | ||