| TrapCLuster Report for TCL9296 |
| Internal ID | 9296 |
||||||
| Accession | TCL9296 |
||||||
| Sequence |
|
||||||
| RNA length | 420 |
||||||
| Overlapping | |||||||
| Blocks | 2 |
||||||
| Traps | 7 |
||||||
| Distance from gene | 203011 |
||||||
| Gene in slice | 0 |
||||||
| Gene in slice (same strand) | 0 |
||||||
| Human Conservation | 0 |
||||||
| Dog Conservation | 0 |
||||||
| Gallus Conservation | 0 |
||||||
| Total Conservation | 0 |
||||||
| LORF Length | 72 |
||||||
| LORF-Blastp Result | 0 |
||||||
| UTRscan Result | 0 |
||||||
| Max UTR length | 0 |
||||||
| Closest Gene (stable_id) | ENSMUSG00000048424 |
||||||
| Closest Gene (name) | |||||||
| Close to OMIM | 0 |
||||||
| Disease | 0 |
||||||
| Go To Ensembl |  |
||||||
| Go To UCSC |  |
| Internal Id | Chromosome | Start | End | Strand | Release |
9296 |
7 |
38668075 |
38670584 |
-1 |
NCBIM34 |
| Longest ORF | Translation | Length | Strand |
| gggaagaatcctttctattctcgggacacgcagatctttc tgcaggcaatctggcaatgctggaggaaaagagggacacc gtggatgaggagatcgatgaaaagaagtcagcttgagaat gacaggggcattgagaaatgcagttctcgttttgccacag ttaatggagactctcacacgggagacagagatacacaacc aggaagactgagagtat |
GKNPFYSRDTQIFLQAIWQCWRKRGTPWMRRSMKRSQLEN DRGIEKCSSRFATVNGDSHTGDRDTQPGRLRV |
72 | + |
| BLASTP Hit ID (ORF) | Description | Score | Start | End | Frac Aligned Query | Num Hsps | Frac Identical | Length | |
| No BLASTP result for Longest-ORF! | |||||||||
| Public Clones | |||
| Private Clones | OST122703 (lexicon) OST100461 (lexicon) OST109878 (lexicon) OST111061 (lexicon) OST50160 (lexicon) OST281398 (lexicon) OST63339 (lexicon) |
||